BRMS1 (NM_015399) Human Mass Spec Standard

CAT#: PH303428

BRMS1 MS Standard C13 and N15-labeled recombinant protein (NP_056214)

Product Images

Coomassie blue staining of purified BRMS1 protein (Cat# TP303428). The protein was produced from HEK293T cells transfected with BRMS1 cDNA clone (Cat# RC203428) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203428
• Predicted MW: 28.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203428 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ
  FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG
  AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG
  PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056214
• RefSeq Size: 1455
• RefSeq ORF: 738
• Synonyms: DKFZp564A063
• Locus ID: 25855
• UniProt ID: Q9HCU9
• Cytogenetics: 11q13.2
• Summary: This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome