PMM2 (NM_000303) Human Mass Spec Standard
CAT#: PH303472
PMM2 MS Standard C13 and N15-labeled recombinant protein (NP_000294)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203472 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC203472 representing NM_000303
Red=Cloning site Green=Tags(s) MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPE NGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEE RIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDK TMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000294 |
RefSeq Size | 2302 |
RefSeq ORF | 738 |
Synonyms | CDG1; CDG1a; CDGS; PMI; PMI1; PMM 2 |
Locus ID | 5373 |
UniProt ID | O15305, A0A0S2Z4J6, Q59F02 |
Cytogenetics | 16p13.2 |
Summary | 'The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424809 | PMM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424809 | Transient overexpression lysate of phosphomannomutase 2 (PMM2) |
USD 396.00 |
|
TP303472 | Recombinant protein of human phosphomannomutase 2 (PMM2) |
USD 823.00 |
|
TP720223 | Recombinant protein of human phosphomannomutase 2 (PMM2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review