POLR1C (NM_203290) Human Mass Spec Standard
CAT#: PH303486
POLR1C MS Standard C13 and N15-labeled recombinant protein (NP_976035)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203486 |
Predicted MW | 39.2 kDa |
Protein Sequence |
>RC203486 protein sequence
Red=Cloning site Green=Tags(s) MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA AIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQF RLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRL DTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_976035 |
RefSeq Size | 1353 |
RefSeq ORF | 1038 |
Synonyms | AC40; HLD11; RPA5; RPA39; RPA40; RPAC1; RPC40; TCS3 |
Locus ID | 9533 |
UniProt ID | O15160 |
Cytogenetics | 6p21.1 |
Summary | The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404374 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC417693 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429225 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404374 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1 |
USD 325.00 |
|
LY417693 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 2 |
USD 325.00 |
|
LY429225 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 2 |
USD 325.00 |
|
TP303486 | Recombinant protein of human polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review