ABHD14B (NM_032750) Human Mass Spec Standard

CAT#: PH303520

ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139)

Product Images

Coomassie blue staining of purified ABHD14B protein (Cat# TP303520). The protein was produced from HEK293T cells transfected with ABHD14B cDNA clone (Cat# RC203520) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203520
• Predicted MW: 22.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203520 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP
  GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD
  KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116139
• RefSeq Size: 2447
• RefSeq ORF: 630
• Synonyms: CIB; HEL-S-299
• Locus ID: 84836
• UniProt ID: Q96IU4, V9HW87
• Cytogenetics: 3p21.2