FAM113B (PCED1B) (NM_138371) Human Mass Spec Standard

CAT#: PH303593

FAM113B MS Standard C13 and N15-labeled recombinant protein (NP_612380)

Product Images

Coomassie blue staining of purified PCED1B protein (Cat# TP303593). The protein was produced from HEK293T cells transfected with PCED1B cDNA clone (Cat# RC203593) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203593
• Predicted MW: 49.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203593 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MILLRASEVRQLLHNKFVVILGDSVHRAVYKDLVLLLQKDRLLTPGQLRARGELNFEQDELVDGGQRGHM
  HNGLNYREVREFRSDHHLVRFYFLTRVYSDYLQTILKELQSGEHAPDLVIMNSCLWDISRYGPNSWRSYL
  ENLENLFQCLGQVLPESCLLVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFD
  VLDLHFHFRHARENLHWDGVHWNGRVHRCLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQ
  ANRNHPALPLSPPLPSPTYRPLLGFPPQRLPLLPLLSPQPPPPILHHQGMPRFPQGPPDACFSSDHTFQS
  DQFYCHSDVPSSAHAGFFVEDNFMVGPQLPMPFFPTPRYQRPAPVVHRGFGRYRPRGPYTPWGQRPRPSK
  RRAPANPEPRPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612380
• RefSeq Size: 2376
• RefSeq ORF: 1296
• Synonyms: FAM113B
• Locus ID: 91523
• UniProt ID: Q96HM7, A0A024R115
• Cytogenetics: 12q13.11
• Summary: This gene encodes a protein that belongs to the GDSL/SGNH-like acyl-esterase family. Members of this family are hydrolases thought to function in modification of biopolymers on the cell surface. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]