AVEN (NM_020371) Human Mass Spec Standard

CAT#: PH303707

AVEN MS Standard C13 and N15-labeled recombinant protein (NP_065104)

Product Images

Coomassie blue staining of purified AVEN protein (Cat# TP303707). The protein was produced from HEK293T cells transfected with AVEN cDNA clone (Cat# RC203707) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203707
• Predicted MW: 38.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203707 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGG
  APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTD
  FSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLE
  VPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGD
  HLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE
  EELEDWLDSMIS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065104
• RefSeq Size: 1551
• RefSeq ORF: 1086
• Synonyms: PDCD12
• Locus ID: 57099
• UniProt ID: Q9NQS1
• Cytogenetics: 15q14
• Summary: Protects against apoptosis mediated by Apaf-1. [UniProtKB/Swiss-Prot Function]