Germany
Japan
United Kingdom
China
PSMG3 (NM_032302) Human Mass Spec Standard
CAT#: PH303835
PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203835 |
| Predicted MW | 13.1 kDa |
| Protein Sequence |
>RC203835 protein sequence
Red=Cloning site Green=Tags(s) MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_115678 |
| RefSeq Size | 1395 |
| RefSeq ORF | 366 |
| Synonyms | C7orf48; PAC3 |
| Locus ID | 84262 |
| UniProt ID | Q9BT73, A0A024R806 |
| Cytogenetics | 7p22.3 |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410244 | PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427395 | PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410244 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 |
USD 396.00 |
|
| LY427395 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 2 |
USD 396.00 |
|
| TP303835 | Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 |
USD 823.00 |
|
| TP760843 | Purified recombinant protein of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review