GALNTL2 (GALNT15) (NM_054110) Human Mass Spec Standard

CAT#: PH303849

GALNTL2 MS Standard C13 and N15-labeled recombinant protein (NP_473451)

Product Images

Coomassie blue staining of purified GALNT15 protein (Cat# TP303849). The protein was produced from HEK293T cells transfected with GALNT15 cDNA clone (Cat# RC203849) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203849
• Predicted MW: 73.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203849 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE
  AEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADED
  GEVSEEEELTPFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFHDEAWSTLLRT
  VHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLV
  FMDAHCECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRK
  ALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQ
  NQDSHSPLDQETTLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLA
  NVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQH
  LCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRF
  DQINAVDER
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_473451
• RefSeq Size: 4641
• RefSeq ORF: 1917
• Synonyms: GALNACT15; GALNT7; GALNT13; GALNTL2; PIH5; pp-GalNAc-T15
• Locus ID: 117248
• UniProt ID: Q8N3T1
• Cytogenetics: 3p25.1
• Summary: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Although it displays a much weaker activity toward all substrates tested compared to GALNT2, it is able to transfer up to seven GalNAc residues to the Muc5AC peptide, suggesting that it can fill vicinal Thr/Ser residues in cooperation with other GALNT proteins. Prefers Muc1a as substrate. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis