c20orf72 (MGME1) (NM_052865) Human Mass Spec Standard

CAT#: PH303886

C20orf72 MS Standard C13 and N15-labeled recombinant protein (NP_443097)

Product Images

Coomassie blue staining of purified MGME1 protein (Cat# TP303886). The protein was produced from HEK293T cells transfected with MGME1 cDNA clone (Cat# RC203886) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203886
• Predicted MW: 39.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203886 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKMKLFQTICRQLRSSKFSVESAALVAFSTSSYSCGRKKKVNPYEEVDQEKYSNLVQSVLSSRGVAQTPG
  SVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVLQQT
  MTKQQVFLLERWKQRMILELGEDGFKEYTSNVFLQGKRFHEALESILSPQETLKERDENLLKSGYIESVQ
  HILKDVSGVRALESAVQHETLNYIGLLDCVAEYQGKLCVIDWKTSEKPKPFIQSTFDNPLQVVAYMGAMN
  HDTNYSFQVQCGLIVVAYKDGSPAHPHFMDAELCSQYWTKWLLRLEEYTEKKKNQNIQKPEYSE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443097
• RefSeq Size: 2142
• RefSeq ORF: 1032
• Synonyms: bA504H3.4; C20orf72; DDK1; MTDPS11
• Locus ID: 92667
• UniProt ID: Q9BQP7
• Cytogenetics: 20p11.23
• Summary: The protein encoded by this gene is a nuclear-encoded mitochondrial protein necessary for the maintenance of mitochondrial genome synthesis. The encoded protein is a RecB-type exonuclease and primarily cleaves single-stranded DNA. Defects in this gene have been associated with mitochondrial DNA depletion syndrome-11. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]