Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Mass Spec Standard

CAT#: PH303907

ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083)

Product Images

Coomassie blue staining of purified ADIPOR1 protein (Cat# TP303907). The protein was produced from HEK293T cells transfected with ADIPOR1 cDNA clone (Cat# RC203907) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203907
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203907 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP
  LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT
  HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS
  GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV
  PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV
  HFYGVSNLQEFRYGLEGGCTDDTLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057083
• RefSeq Size: 2184
• RefSeq ORF: 1125
• Synonyms: ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
• Locus ID: 51094
• UniProt ID: Q96A54
• Cytogenetics: 1q32.1
• Summary: This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway