APOBEC3C (NM_014508) Human Mass Spec Standard

CAT#: PH303971

APOBEC3C MS Standard C13 and N15-labeled recombinant protein (NP_055323)

Product Images

Coomassie blue staining of purified APOBEC3C protein (Cat# TP303971). The protein was produced from HEK293T cells transfected with APOBEC3C cDNA clone (Cat# RC203971) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203971
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203971 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC
  FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ
  EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055323
• RefSeq Size: 1127
• RefSeq ORF: 570
• Synonyms: A3C; APOBEC1L; ARDC2; ARDC4; ARP5; bK150C2.3; PBI
• Locus ID: 27350
• UniProt ID: Q9NRW3
• Cytogenetics: 22q13.1
• Summary: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq, Jul 2008]