GADD45A (NM_001924) Human Mass Spec Standard

CAT#: PH304005

GADD45A MS Standard C13 and N15-labeled recombinant protein (NP_001915)

Product Images

Coomassie blue staining of purified GADD45A protein (Cat# TP304005). The protein was produced from HEK293T cells transfected with GADD45A cDNA clone (Cat# RC204005) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204005
• Predicted MW: 18.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204005 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA
  LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL
  SQLICFCRESRYMDQWVPVINLPER
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001915
• RefSeq Size: 1398
• RefSeq ORF: 495
• Synonyms: DDIT1; GADD45
• Locus ID: 1647
• UniProt ID: P24522
• Cytogenetics: 1p31.3
• Summary: 'This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway