14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard
CAT#: PH304045
SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204045 |
Predicted MW | 27.8 kDa |
Protein Sequence |
>RC204045 protein sequence
Red=Cloning site Green=Tags(s) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006133 |
RefSeq Size | 1336 |
RefSeq ORF | 744 |
Synonyms | YWHAS |
Locus ID | 2810 |
UniProt ID | P31947 |
Cytogenetics | 1p36.11 |
Summary | 'This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cell cycle, p53 signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401850 | SFN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401850 | Transient overexpression lysate of stratifin (SFN) |
USD 396.00 |
|
TP304045 | Recombinant protein of human stratifin (SFN) |
USD 823.00 |
|
TP720151 | Recombinant protein of human stratifin (SFN) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review