14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard

CAT#: PH304045

SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)

Product Images

Coomassie blue staining of purified SFN protein (Cat# TP304045). The protein was produced from HEK293T cells transfected with SFN cDNA clone (Cat# RC204045) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204045
• Predicted MW: 27.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204045 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN
  EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK
  KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE
  DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006133
• RefSeq Size: 1336
• RefSeq ORF: 744
• Synonyms: YWHAS
• Locus ID: 2810
• UniProt ID: P31947
• Cytogenetics: 1p36.11
• Summary: 'This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cell cycle, p53 signaling pathway