PGAM1 (NM_002629) Human Mass Spec Standard

CAT#: PH304054

PGAM1 MS Standard C13 and N15-labeled recombinant protein (NP_002620)

Product Images

Coomassie blue staining of purified PGAM1 protein (Cat# TP304054). The protein was produced from HEK293T cells transfected with PGAM1 cDNA clone (Cat# RC204054) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204054
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204054 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV
  LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
  RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL
  PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002620
• RefSeq Size: 1762
• RefSeq ORF: 762
• Synonyms: HEL-S-35; PGAM-B; PGAMA
• Locus ID: 5223
• UniProt ID: P18669, Q6FHU2
• Cytogenetics: 10q24.1
• Summary: 'The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]'
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways