ERGIC3 (NM_015966) Human Mass Spec Standard

CAT#: PH304084

ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_057050)

Product Images

Coomassie blue staining of purified ERGIC3 protein (Cat# TP304084). The protein was produced from HEK293T cells transfected with ERGIC3 cDNA clone (Cat# RC204084) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204084
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204084 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI
  NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD
  RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV
  AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV
  KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA
  IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057050
• RefSeq Size: 1368
• RefSeq ORF: 1149
• Synonyms: C2orf47; C20orf47; CGI-54; dJ477O4.2; Erv46; NY-BR-84; PRO0989; SDBCAG84
• Locus ID: 51614
• UniProt ID: Q9Y282, A2TJK5
• Cytogenetics: 20q11.22
• Protein Families: Transmembrane