Rad6 (UBE2A) (NM_003336) Human Mass Spec Standard
CAT#: PH304194
UBE2A MS Standard C13 and N15-labeled recombinant protein (NP_003327)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204194 |
Predicted MW | 17.3 kDa |
Protein Sequence |
>RC204194 protein sequence
Red=Cloning site Green=Tags(s) MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR VSAIVEQSWRDC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003327 |
RefSeq Size | 1878 |
RefSeq ORF | 456 |
Synonyms | HHR6A; MRXS30; MRXSN; RAD6A; UBC2 |
Locus ID | 7319 |
UniProt ID | P49459 |
Cytogenetics | Xq24 |
Summary | 'The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]' |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418754 | UBE2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418754 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1 |
USD 396.00 |
|
TP304194 | Recombinant protein of human ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1 |
USD 823.00 |
|
TP720160 | Recombinant protein of human ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review