Rad6 (UBE2A) (NM_003336) Human Mass Spec Standard

CAT#: PH304194

UBE2A MS Standard C13 and N15-labeled recombinant protein (NP_003327)

Product Images

Coomassie blue staining of purified UBE2A protein (Cat# TP304194). The protein was produced from HEK293T cells transfected with UBE2A cDNA clone (Cat# RC204194) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204194
• Predicted MW: 17.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204194 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV
  RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR
  VSAIVEQSWRDC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003327
• RefSeq Size: 1878
• RefSeq ORF: 456
• Synonyms: HHR6A; MRXS30; MRXSN; RAD6A; UBC2
• Locus ID: 7319
• UniProt ID: P49459
• Cytogenetics: Xq24
• Summary: 'The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]'
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis