DPH3 (NM_206831) Human Mass Spec Standard

CAT#: PH304203

DPH3 MS Standard C13 and N15-labeled recombinant protein (NP_996662)

Product Images

Coomassie blue staining of purified DPH3 protein (Cat# TP304203). The protein was produced from HEK293T cells transfected with DPH3 cDNA clone (Cat# RC204203) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204203
• Predicted MW: 9.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204203 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV
  PAPSANKELVKC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996662
• RefSeq Size: 4065
• RefSeq ORF: 246
• Synonyms: DELGIP; DELGIP1; DESR1; DPH3A; KTI11; ZCSL2
• Locus ID: 285381
• UniProt ID: Q96FX2
• Cytogenetics: 3p25.1
• Summary: This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009]