DPH3 (NM_206831) Human Mass Spec Standard
CAT#: PH304203
DPH3 MS Standard C13 and N15-labeled recombinant protein (NP_996662)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204203 |
Predicted MW | 9.2 kDa |
Protein Sequence |
>RC204203 protein sequence
Red=Cloning site Green=Tags(s) MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV PAPSANKELVKC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_996662 |
RefSeq Size | 4065 |
RefSeq ORF | 246 |
Synonyms | DELGIP; DELGIP1; DESR1; DPH3A; KTI11; ZCSL2 |
Locus ID | 285381 |
UniProt ID | Q96FX2 |
Cytogenetics | 3p25.1 |
Summary | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404231 | DPH3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404231 | Transient overexpression lysate of DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1 |
USD 396.00 |
|
TP304203 | Recombinant protein of human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review