G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Mass Spec Standard

CAT#: PH304215

GNAI2 MS Standard C13 and N15-labeled recombinant protein (NP_002061)

Product Images

Coomassie blue staining of purified GNAI2 protein (Cat# TP304215). The protein was produced from HEK293T cells transfected with GNAI2 cDNA clone (Cat# RC204215) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204215
• Predicted MW: 40.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204215 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR
  AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC
  FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK
  KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT
  HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK
  DCGLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002061
• RefSeq Size: 2258
• RefSeq ORF: 1065
• Synonyms: GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
• Locus ID: 2771
• UniProt ID: P04899, B3KP24
• Cytogenetics: 3p21.31
• Summary: The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction