SCAND1 (NM_016558) Human Mass Spec Standard
CAT#: PH304370
SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_057642)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204370 |
Predicted MW | 19.1 kDa |
Protein Sequence |
>RC204370 protein sequence
Red=Cloning site Green=Tags(s) MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057642 |
RefSeq Size | 1388 |
RefSeq ORF | 537 |
Synonyms | RAZ1; SDP1 |
Locus ID | 51282 |
UniProt ID | P57086, Q9NZG6 |
Cytogenetics | 20q11.23 |
Summary | This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409491 | SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC413912 | SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409491 | Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 2 |
USD 325.00 |
|
LY413912 | Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 1 |
USD 325.00 |
|
PH300079 | SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_361012) |
USD 2,055.00 |
|
TP300079 | Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 2 |
USD 823.00 |
|
TP304370 | Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review