POP5 (NM_015918) Human Mass Spec Standard
CAT#: PH304400
POP5 MS Standard C13 and N15-labeled recombinant protein (NP_057002)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204400 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC204400 protein sequence
Red=Cloning site Green=Tags(s) MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK SVTRSCLLEEEEESGEEAAEAME myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057002 |
RefSeq Size | 801 |
RefSeq ORF | 489 |
Synonyms | hPop5; HSPC004; RPP2; RPP20 |
Locus ID | 51367 |
UniProt ID | Q969H6 |
Cytogenetics | 12q24.31 |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414321 | POP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414321 | Transient overexpression lysate of processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) (POP5), transcript variant 1 |
USD 396.00 |
|
TP304400 | Recombinant protein of human processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) (POP5), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review