HDHD1A (PUDP) (NM_012080) Human Mass Spec Standard

CAT#: PH304419

HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212)

Product Images

Coomassie blue staining of purified PUDP protein (Cat# TP304419). The protein was produced from HEK293T cells transfected with PUDP cDNA clone (Cat# RC204419) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204419
• Predicted MW: 23.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204419 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE
  VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI
  FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL
  PSYE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036212
• RefSeq Size: 2155
• RefSeq ORF: 642
• Synonyms: DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A
• Locus ID: 8226
• UniProt ID: Q08623
• Cytogenetics: Xp22.31
• Summary: This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]