HOXB7 (NM_004502) Human Mass Spec Standard

CAT#: PH304495

HOXB7 MS Standard C13 and N15-labeled recombinant protein (NP_004493)

Product Images

Coomassie blue staining of purified HOXB7 protein (Cat# TP304495). The protein was produced from HEK293T cells transfected with HOXB7 cDNA clone (Cat# RC204495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204495
• Predicted MW: 24 kDa
• Protein Sequence:
  Sequence Link

  >RC204495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSA
  AGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRG
  RQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAE
  AEEEEEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004493
• RefSeq Size: 1377
• RefSeq ORF: 651
• Synonyms: HHO.C1; Hox-2.3; HOX2; HOX2C
• Locus ID: 3217
• UniProt ID: P09629
• Cytogenetics: 17q21.32
• Summary: 'This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors