ANKRD49 (NM_017704) Human Mass Spec Standard

CAT#: PH304657

ANKRD49 MS Standard C13 and N15-labeled recombinant protein (NP_060174)

Product Images

Coomassie blue staining of purified ANKRD49 protein (Cat# TP304657). The protein was produced from HEK293T cells transfected with ANKRD49 cDNA clone (Cat# RC204657) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204657
• Predicted MW: 27.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204657 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKM
  EKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVD
  GWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEE
  TAFDIARRTSIYHYLFEIVEGCTNSSPQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060174
• RefSeq Size: 1924
• RefSeq ORF: 717
• Synonyms: FGIF; GBIF
• Locus ID: 54851
• UniProt ID: Q8WVL7, A0A024R398
• Cytogenetics: 11q21
• Summary: Induces HBG1 expression (PubMed:16131492, PubMed:11162141). May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway. [UniProtKB/Swiss-Prot Function]