VPREB3 (NM_013378) Human Mass Spec Standard

CAT#: PH304662

VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510)

Product Images

Coomassie blue staining of purified VPREB3 protein (Cat# TP304662). The protein was produced from HEK293T cells transfected with VPREB3 cDNA clone (Cat# RC204662) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204662
• Predicted MW: 13.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204662 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLY
  YRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037510
• RefSeq Size: 602
• RefSeq ORF: 369
• Synonyms: 8HS20; N27C7-2
• Locus ID: 29802
• UniProt ID: Q9UKI3
• Cytogenetics: 22q11
• Summary: The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. [provided by RefSeq, Apr 2015]
• Protein Families: Druggable Genome