PLAC1 (NM_021796) Mass Spec Standard

CAT#: PH304793

PLAC1 MS Standard C13 and N15-labeled recombinant protein (NP_068568)

Specifications

Product Data

• Tag: C-Myc/DDK
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204793
• Predicted MW: 23.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204793 representing NM_021796
  Red=Cloning site Green=Tags(s)
  
  MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHA
  YQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATA
  QKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIG
  SM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: > 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068568
• RefSeq Size: 1126
• RefSeq ORF: 636
• Synonyms: CT92; OOSP2B; OOSP2L
• Locus ID: 10761
• UniProt ID: Q9HBJ0
• Cytogenetics: Xq26.3
• Protein Families: Secreted Protein