Hex (HHEX) (NM_002729) Human Mass Spec Standard

CAT#: PH304815

HHEX MS Standard C13 and N15-labeled recombinant protein (NP_002720)

Product Images

Coomassie blue staining of purified HHEX protein (Cat# TP304815). The protein was produced from HEK293T cells transfected with HHEX cDNA clone (Cat# RC204815) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204815
• Predicted MW: 29.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204815 representing NM_002729
  Red=Cloning site Green=Tags(s)
  
  MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY
  EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG
  QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES
  LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002720
• RefSeq Size: 1772
• RefSeq ORF: 810
• Synonyms: HEX; HMPH; HOX11L-PEN; PRH; PRHX
• Locus ID: 3087
• UniProt ID: Q03014
• Cytogenetics: 10q23.33
• Summary: This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young