Hex (HHEX) (NM_002729) Human Mass Spec Standard
CAT#: PH304815
HHEX MS Standard C13 and N15-labeled recombinant protein (NP_002720)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204815 |
Predicted MW | 29.8 kDa |
Protein Sequence |
>RC204815 representing NM_002729
Red=Cloning site Green=Tags(s) MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002720 |
RefSeq Size | 1772 |
RefSeq ORF | 810 |
Synonyms | HEX; HMPH; HOX11L-PEN; PRH; PRHX |
Locus ID | 3087 |
UniProt ID | Q03014 |
Cytogenetics | 10q23.33 |
Summary | This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419139 | HHEX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419139 | Transient overexpression lysate of hematopoietically expressed homeobox (HHEX) |
USD 325.00 |
|
TP304815 | Recombinant protein of human hematopoietically expressed homeobox (HHEX) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review