IRAK (IRAK1) (NM_001025243) Human Mass Spec Standard
CAT#: PH304869
IRAK1 MS Standard C13 and N15-labeled recombinant protein (NP_001020414)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204869 |
Predicted MW | 68 kDa |
Protein Sequence |
>RC204869 protein sequence
Red=Cloning site Green=Tags(s) MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCWPLCEISRGTH NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG QRAVKTHGARTKYLVYERLEKLQAVVAGVPGHLEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSG ASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRP TAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDE FQS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020414 |
RefSeq Size | 3352 |
RefSeq ORF | 1899 |
Synonyms | IRAK; pelle |
Locus ID | 3654 |
UniProt ID | P51617 |
Cytogenetics | Xq28 |
Summary | 'This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400603 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422494 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422495 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425491 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400603 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 1 |
USD 605.00 |
|
LY422494 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 2 |
USD 605.00 |
|
LY422495 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 3 |
USD 396.00 |
|
LY425491 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 2 |
USD 605.00 |
|
TP304869 | Recombinant protein of human interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 3 |
USD 867.00 |
|
TP761632 | Purified recombinant protein of Human interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review