HIST4H4 (NM_175054) Human Mass Spec Standard

CAT#: PH305064

HIST4H4 MS Standard C13 and N15-labeled recombinant protein (NP_778224)

Product Images

Coomassie blue staining of purified HIST4H4 protein (Cat# TP305064). The protein was produced from HEK293T cells transfected with HIST4H4 cDNA clone (Cat# RC205064) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205064
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205064 representing NM_175054
  Red=Cloning site Green=Tags(s)
  
  MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
  VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_778224
• RefSeq Size: 412
• RefSeq ORF: 309
• Synonyms: H4/p
• Locus ID: 121504
• UniProt ID: P62805, B2R4R0
• Cytogenetics: 12p12.3
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. [provided by RefSeq, Aug 2015]
• Protein Pathways: Systemic lupus erythematosus