SUCLA2 (NM_003850) Human Mass Spec Standard

CAT#: PH305212

SUCLA2 MS Standard C13 and N15-labeled recombinant protein (NP_003841)

Product Images

Coomassie blue staining of purified SUCLA2 protein (Cat# TP305212). The protein was produced from HEK293T cells transfected with SUCLA2 cDNA clone (Cat# RC205212) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205212
• Predicted MW: 50.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205212 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVS
  VPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKL
  FTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDI
  EEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSN
  SAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGG
  GATVHQVTEAFKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALI
  ADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLPI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003841
• RefSeq Size: 2182
• RefSeq ORF: 1389
• Synonyms: A-BETA; A-SCS; MTDPS5; SCS-betaA
• Locus ID: 8803
• UniProt ID: Q9P2R7, E5KS60, Q9Y4T0
• Cytogenetics: 13q14.2
• Summary: Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6. [provided by RefSeq, Jul 2008]
• Protein Pathways: Citrate cycle (TCA cycle), Metabolic pathways, Propanoate metabolism