PCTAIRE2 (CDK17) (NM_002595) Human Mass Spec Standard

CAT#: PH305318

CDK17 MS Standard C13 and N15-labeled recombinant protein (NP_002586)

Product Images

Coomassie blue staining of purified CDK17 protein (Cat# TP305318). The protein was produced from HEK293T cells transfected with CDK17 cDNA clone (Cat# RC205318) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205318
• Predicted MW: 59.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205318 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPL
  RRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMED
  LNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGR
  SKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDD
  CGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVV
  TLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNE
  EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIF
  SLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002586
• RefSeq Size: 4194
• RefSeq ORF: 1569
• Synonyms: PCTAIRE2; PCTK2
• Locus ID: 5128
• UniProt ID: Q00537, A0A024RBH0
• Cytogenetics: 12q23.1
• Summary: The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to a rat protein that is thought to play a role in terminally differentiated neurons. Alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome, Protein Kinase