TSSK1 (TSSK1B) (NM_032028) Human Mass Spec Standard

CAT#: PH305395

TSSK1B MS Standard C13 and N15-labeled recombinant protein (NP_114417)

Product Images

Coomassie blue staining of purified TSSK1B protein (Cat# TP305395). The protein was produced from HEK293T cells transfected with TSSK1B cDNA clone (Cat# RC205395) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205395
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205395 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC
  SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD
  NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV
  CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP
  SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST
  METEEGPPQQPPETRAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114417
• RefSeq Size: 2478
• RefSeq ORF: 1101
• Synonyms: FKSG81; SPOGA4; STK22D; TSK1; TSSK1
• Locus ID: 83942
• UniProt ID: Q9BXA7, A0ZT98
• Cytogenetics: 5q22.2
• Summary: TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Protein Kinase