PPP3R2 (NM_147180) Human Mass Spec Standard

CAT#: PH305406

PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709)

Product Images

Coomassie blue staining of purified PPP3R2 protein (Cat# TP305406). The protein was produced from HEK293T cells transfected with PPP3R2 cDNA clone (Cat# RC205406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205406
• Predicted MW: 19.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGD
  GEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTI
  IILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_671709
• RefSeq Size: 3401
• RefSeq ORF: 519
• Synonyms: PPP3RL
• Locus ID: 5535
• UniProt ID: Q96LZ3, A0A494C014
• Cytogenetics: 9q31.1
• Summary: ''
• Protein Families: Phosphatase
• Protein Pathways: Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway