Non Neuronal Enolase (ENO1) (NM_001428) Human Mass Spec Standard

CAT#: PH305494

ENO1 MS Standard C13 and N15-labeled recombinant protein (NP_001419)

Product Images

Coomassie blue staining of purified ENO1 protein (Cat# TP305494). The protein was produced from HEK293T cells transfected with ENO1 cDNA clone (Cat# RC205494) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205494
• Predicted MW: 47.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205494 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN
  KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN
  SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE
  GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY
  KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
  TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
  AKFAGRNFRNPLAK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001419
• RefSeq Size: 2204
• RefSeq ORF: 1302
• Synonyms: ENO1L1; HEL-S-17; MPB1; NNE; PPH
• Locus ID: 2023
• UniProt ID: P06733, A0A024R4F1
• Cytogenetics: 1p36.23
• Summary: 'This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. [provided by RefSeq, Jan 2011]'
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation