Ribonuclease A (RNASE1) (NM_198235) Human Mass Spec Standard

CAT#: PH305620

RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878)

Product Images

Coomassie blue staining of purified RNASE1 protein (Cat# TP305620). The protein was produced from HEK293T cells transfected with RNASE1 cDNA clone (Cat# RC205620) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205620
• Predicted MW: 17.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205620 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP
  VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG
  SPYVPVHFDASVEDST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_937878
• RefSeq Size: 903
• RefSeq ORF: 468
• Synonyms: RAC1; RIB1; RNS1
• Locus ID: 6035
• UniProt ID: P07998, W0UV93
• Cytogenetics: 14q11.2
• Summary: 'This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein, Transmembrane