FLVCR2 (NM_017791) Human Mass Spec Standard

CAT#: PH305665

FLVCR2 MS Standard C13 and N15-labeled recombinant protein (NP_060261)

Product Images

Coomassie blue staining of purified FLVCR2 protein (Cat# TP305665). The protein was produced from HEK293T cells transfected with FLVCR2 cDNA clone (Cat# RC205665) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205665
• Predicted MW: 57.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205665 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSS
  GPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLP
  VAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANE
  VSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPP
  SRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIG
  LTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP
  LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKAD
  LRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060261
• RefSeq Size: 3669
• RefSeq ORF: 1578
• Synonyms: C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH; SLC49A2
• Locus ID: 55640
• UniProt ID: Q9UPI3
• Cytogenetics: 14q24.3
• Summary: This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
• Protein Families: Transmembrane