PCID1 (EIF3M) (NM_006360) Human Mass Spec Standard

CAT#: PH305694

EIF3M MS Standard C13 and N15-labeled recombinant protein (NP_006351)

Product Images

Coomassie blue staining of purified EIF3M protein (Cat# TP305694). The protein was produced from HEK293T cells transfected with EIF3M cDNA clone (Cat# RC205694) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205694
• Predicted MW: 42.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205694 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSL
  LLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYI
  PTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVR
  ALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLL
  TFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQL
  YDTLNAWKQNLNKVKNSLLSLSDT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006351
• RefSeq Size: 1338
• RefSeq ORF: 1122
• Synonyms: B5; GA17; hfl-B5; PCID1; TANGO7
• Locus ID: 10480
• UniProt ID: Q7L2H7
• Cytogenetics: 11p13
• Summary: This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome. [provided by RefSeq, Dec 2011]