LMAN2 (NM_006816) Human Mass Spec Standard

CAT#: PH305704

LMAN2 MS Standard C13 and N15-labeled recombinant protein (NP_006807)

Product Images

Coomassie blue staining of purified LMAN2 protein (Cat# TP305704). The protein was produced from HEK293T cells transfected with LMAN2 cDNA clone (Cat# RC205704) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205704
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205704 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSS
  SMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRD
  RLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRD
  HDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEH
  TPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQE
  RNKRFY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006807
• RefSeq Size: 1853
• RefSeq ORF: 1068
• Synonyms: C5orf8; GP36B; VIP36
• Locus ID: 10960
• UniProt ID: Q12907, A0A384NPY7
• Cytogenetics: 5q35.3
• Summary: This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. [provided by RefSeq, Oct 2008]
• Protein Families: Transmembrane