PLTP (NM_006227) Human Mass Spec Standard
CAT#: PH305797
PLTP MS Standard C13 and N15-labeled recombinant protein (NP_006218)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205797 |
Predicted MW | 54.7 kDa |
Protein Sequence |
>RC205797 protein sequence
Red=Cloning site Green=Tags(s) MALFGALFLALLAGAHAVFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKV TELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMK VSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVD ELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESY FRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASV TIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADVRASTAPTPST AAV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006218 |
RefSeq Size | 2100 |
RefSeq ORF | 1479 |
Synonyms | BPIFE; HDLCQ9 |
Locus ID | 5360 |
UniProt ID | P55058 |
Cytogenetics | 20q13.12 |
Summary | 'The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401875 | PLTP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405442 | PLTP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401875 | Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 1 |
USD 396.00 |
|
LY405442 | Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 2 |
USD 396.00 |
|
PH302925 | PLTP MS Standard C13 and N15-labeled recombinant protein (NP_872617) |
USD 2,055.00 |
|
TP302925 | Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 2 |
USD 439.00 |
|
TP305797 | Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review