CRYZL1 (NM_145858) Human Mass Spec Standard

CAT#: PH305953

CRYZL1 MS Standard C13 and N15-labeled recombinant protein (NP_665857)

Product Images

Coomassie blue staining of purified CRYZL1 protein (Cat# TP305953). The protein was produced from HEK293T cells transfected with CRYZL1 cDNA clone (Cat# RC205953) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205953
• Predicted MW: 38.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205953 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV
  LDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLS
  HLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCL
  EETGGLGVDIVLDAGVRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA
  TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_665857
• RefSeq Size: 1726
• RefSeq ORF: 1047
• Synonyms: 4P11; QOH-1
• Locus ID: 9946
• UniProt ID: O95825
• Cytogenetics: 21q22.11
• Summary: This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but their full-length nature has not been completely determined. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome