DIRAS1 (NM_145173) Human Mass Spec Standard
CAT#: PH306160
DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206160 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC206160 protein sequence
Red=Cloning site Green=Tags(s) MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_660156 |
RefSeq Size | 3412 |
RefSeq ORF | 594 |
Synonyms | Di-Ras1; GBTS1; RIG |
Locus ID | 148252 |
UniProt ID | O95057 |
Cytogenetics | 19p13.3 |
Summary | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. [supplied by OMIM, Apr 2004] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408035 | DIRAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408035 | Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1) |
USD 396.00 |
|
TP306160 | Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review