TXNDC (TMX1) (NM_030755) Human Mass Spec Standard

CAT#: PH306187

TMX1 MS Standard C13 and N15-labeled recombinant protein (NP_110382)

Product Images

Coomassie blue staining of purified TMX1 protein (Cat# TP306187). The protein was produced from HEK293T cells transfected with TMX1 cDNA clone (Cat# RC206187) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206187
• Predicted MW: 31.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206187 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFA
  EWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSS
  WFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSK
  RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_110382
• RefSeq Size: 4119
• RefSeq ORF: 840
• Synonyms: PDIA11; TMX; TXNDC; TXNDC1
• Locus ID: 81542
• UniProt ID: Q9H3N1
• Cytogenetics: 14q22.1
• Summary: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides. [provided by RefSeq, Jan 2017]
• Protein Families: Druggable Genome, Transcription Factors, Transmembrane