AIM (CD5L) (NM_005894) Human Mass Spec Standard

CAT#: PH306528

CD5L MS Standard C13 and N15-labeled recombinant protein (NP_005885)

Product Images

Coomassie blue staining of purified CD5L protein (Cat# TP306528). The protein was produced from HEK293T cells transfected with CD5L cDNA clone (Cat# RC206528) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206528
• Predicted MW: 38.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206528 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCRELGCGAA
  SGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
  ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSG
  REATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQV
  VCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005885
• RefSeq Size: 2248
• RefSeq ORF: 1041
• Synonyms: AIM; API6; CT-2; hAIM; PRO229; SP-ALPHA; Spalpha
• Locus ID: 922
• UniProt ID: O43866
• Cytogenetics: 1q23.1
• Summary: ''
• Protein Families: Druggable Genome, Secreted Protein