Glycerol 3 Phosphate Dehydrogenase (GPD1) (NM_005276) Human Mass Spec Standard
CAT#: PH306538
GPD1 MS Standard C13 and N15-labeled recombinant protein (NP_005267)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206538 |
Predicted MW | 37.6 kDa |
Protein Sequence |
>RC206538 protein sequence
Red=Cloning site Green=Tags(s) MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLP PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERL GIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVG AGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART GKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005267 |
RefSeq Size | 3083 |
RefSeq ORF | 1047 |
Synonyms | GPD-C; GPDH-C; HTGTI |
Locus ID | 2819 |
UniProt ID | P21695, A0A024R138 |
Cytogenetics | 12q13.12 |
Summary | 'This gene encodes a member of the NAD-dependent glycerol-3-phosphate dehydrogenase family. The encoded protein plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of dihydroxyacetone phosphate (DHAP) and reduced nicotine adenine dinucleotide (NADH) to glycerol-3-phosphate (G3P) and NAD+. The encoded cytosolic protein and mitochondrial glycerol-3-phosphate dehydrogenase also form a glycerol phosphate shuttle that facilitates the transfer of reducing equivalents from the cytosol to mitochondria. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]' |
Protein Pathways | Glycerophospholipid metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417409 | GPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417409 | Transient overexpression lysate of glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) |
USD 325.00 |
|
TP306538 | Recombinant protein of human glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) |
USD 823.00 |
|
TP720715 | Purified recombinant protein of Human glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review