CART (CARTPT) (NM_004291) Human Mass Spec Standard

CAT#: PH306552

CARTPT MS Standard C13 and N15-labeled recombinant protein (NP_004282)

Product Images

Coomassie blue staining of purified CARTPT protein (Cat# TP306552). The protein was produced from HEK293T cells transfected with CARTPT cDNA clone (Cat# RC206552) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206552
• Predicted MW: 12.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206552 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVP
  IYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004282
• RefSeq Size: 933
• RefSeq ORF: 348
• Synonyms: CART
• Locus ID: 9607
• UniProt ID: Q16568
• Cytogenetics: 5q13.2
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016]
• Protein Families: Secreted Protein