ASPA (NM_000049) Human Mass Spec Standard

CAT#: PH306564

ASPA MS Standard C13 and N15-labeled recombinant protein (NP_000040)

Product Images

Coomassie blue staining of purified ASPA protein (Cat# TP306564). The protein was produced from HEK293T cells transfected with ASPA cDNA clone (Cat# RC206564) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206564
• Predicted MW: 35.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206564 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN
  RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF
  HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN
  EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP
  VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000040
• RefSeq Size: 1435
• RefSeq ORF: 939
• Synonyms: ACY2; ASP
• Locus ID: 443
• UniProt ID: P45381, Q6FH48
• Cytogenetics: 17p13.2
• Summary: 'This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Histidine metabolism