PNMT (NM_002686) Human Mass Spec Standard
CAT#: PH306586
PNMT MS Standard C13 and N15-labeled recombinant protein (NP_002677)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206586 |
Predicted MW | 30.9 kDa |
Protein Sequence |
>RC206586 protein sequence
Red=Cloning site Green=Tags(s) MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV GL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002677 |
RefSeq Size | 958 |
RefSeq ORF | 846 |
Synonyms | PENT; PNMTase |
Locus ID | 5409 |
UniProt ID | P11086 |
Cytogenetics | 17q12 |
Summary | 'The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]' |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400946 | PNMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400946 | Transient overexpression lysate of phenylethanolamine N-methyltransferase (PNMT) |
USD 396.00 |
|
TP306586 | Recombinant protein of human phenylethanolamine N-methyltransferase (PNMT) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review