PNMT (NM_002686) Human Mass Spec Standard

CAT#: PH306586

PNMT MS Standard C13 and N15-labeled recombinant protein (NP_002677)

Product Images

Coomassie blue staining of purified PNMT protein (Cat# TP306586). The protein was produced from HEK293T cells transfected with PNMT cDNA clone (Cat# RC206586) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206586
• Predicted MW: 30.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206586 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV
  SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW
  QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH
  LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
  GL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002677
• RefSeq Size: 958
• RefSeq ORF: 846
• Synonyms: PENT; PNMTase
• Locus ID: 5409
• UniProt ID: P11086
• Cytogenetics: 17q12
• Summary: 'The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tyrosine metabolism