RAI2 (NM_021785) Human Mass Spec Standard

CAT#: PH306638

RAI2 MS Standard C13 and N15-labeled recombinant protein (NP_068557)

Product Images

Coomassie blue staining of purified RAI2 protein (Cat# TP306638). The protein was produced from HEK293T cells transfected with RAI2 cDNA clone (Cat# RC206638) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206638
• Predicted MW: 57.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206638 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMA
  LKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVL
  PQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYA
  PVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSSSFPKPPSSFGLHPFKGTQ
  TPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAPLDLSVAAH
  RKSEPPPETLYDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG
  EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGN
  AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068557
• RefSeq Size: 2229
• RefSeq ORF: 1590
• Synonyms: OTTHUMP00000022997; OTTHUMP00000022998; retinoic acid induced 2
• Locus ID: 10742
• UniProt ID: Q9Y5P3, A0A024RBZ8, B3KPD7, B2RBE9
• Cytogenetics: Xp22.13
• Summary: Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked cognitive disability, oral-facial-digital syndrome, and Fried syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]