C20orf85 (NM_178456) Human Mass Spec Standard

CAT#: PH306670

C20orf85 MS Standard C13 and N15-labeled recombinant protein (NP_848551)

Product Images

Coomassie blue staining of purified C20orf85 protein (Cat# TP306670). The protein was produced from HEK293T cells transfected with C20orf85 cDNA clone (Cat# RC206670) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206670
• Predicted MW: 15.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206670 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPTPKPKIELPER
  FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848551
• RefSeq Size: 792
• RefSeq ORF: 411
• Synonyms: bA196N14.1; LLC1
• Locus ID: 128602
• UniProt ID: Q9H1P6
• Cytogenetics: 20q13.32