PDPK1 (NM_031268) Human Mass Spec Standard

CAT#: PH306746

PDPK1 MS Standard C13 and N15-labeled recombinant protein (NP_112558)

Product Images

Coomassie blue staining of purified PDPK1 protein (Cat# TP306746). The protein was produced from HEK293T cells transfected with PDPK1 cDNA clone (Cat# RC206746) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206746
• Predicted MW: 48.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206746 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQP
  PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYATRANSFVGTAQYVSPELLTEKSACKSSDLWA
  LGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
  AHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQR
  SGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
  LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRY
  QSHPDAAVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112558
• RefSeq Size: 6862
• RefSeq ORF: 1287
• Synonyms: PDK1; PDPK2; PDPK2P; PRO0461
• Locus ID: 5170
• UniProt ID: O15530
• Cytogenetics: 16p13.3
• Summary: ''
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Endometrial cancer, Focal adhesion, Insulin signaling pathway, mTOR signaling pathway, Non-small cell lung cancer, PPAR signaling pathway, Prostate cancer