C2orf76 (NM_001017927) Human Mass Spec Standard
CAT#: PH306786
C2orf76 MS Standard C13 and N15-labeled recombinant protein (NP_001017927)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206786 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC206786 protein sequence
Red=Cloning site Green=Tags(s) MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYDALKIIHQA HKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001017927 |
RefSeq Size | 950 |
RefSeq ORF | 378 |
Synonyms | AIM29 |
Locus ID | 130355 |
UniProt ID | Q3KRA6 |
Cytogenetics | 2q14.2 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422756 | C2orf76 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY422756 | Transient overexpression lysate of chromosome 2 open reading frame 76 (C2orf76) |
USD 396.00 |
|
TP306786 | Recombinant protein of human chromosome 2 open reading frame 76 (C2orf76) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review